PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.R8PMF
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 80aa    MW: 9101.88 Da    PI: 5.6983
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.R8PMFgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.24.5e-093172245
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                       ++++E  l+ +  k+ G + W++Ia +++ gRt+ ++  +w 
      Aradu.R8PMF 31 VEFSEDEKTLISRMYKLVGDR-WSLIAGRIP-GRTADEIEKYWT 72
                     679****************99.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.6422579IPR017930Myb domain
SMARTSM007172.5E-72977IPR001005SANT/Myb domain
PfamPF002494.9E-83172IPR001005SANT/Myb domain
SuperFamilySSF466895.46E-93175IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-123273IPR009057Homeodomain-like
CDDcd001673.19E-63271No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MDDIDHSSSS SSSQHVSANS TEQVSNRASK VEFSEDEKTL ISRMYKLVGD RWSLIAGRIP  60
GRTADEIEKY WTSRYSSRNE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015936053.15e-52PREDICTED: MYB-like transcription factor ETC3
SwissprotO220591e-19CPC_ARATH; Transcription factor CPC
TrEMBLB9SUR95e-30B9SUR9_RICCO; Triptychon and cpc, putative
STRINGGLYMA12G32130.35e-28(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.11e-20MYB_related family protein